SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_1201 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456442.Mboo_1201
Domain Number 1 Region: 3-76,166-340
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.26e-67
Family Bacterial dinuclear zinc exopeptidases 0.0000134
Further Details:      
 
Domain Number 2 Region: 66-174
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.11e-33
Family Aminopeptidase/glucanase lid domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_1201
Sequence length 345
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MVKELLRKLSNAHGVSGSEGSVFALIKKELKGCVDEITEDPMGNLIAVRHGNKSKVMLAA
HMDEIGLMVKYIDDKGFLRFITLGGWYGPTLYNQRVIVHGTKGDRIGVIGGKPPHMMDED
ERKKGVKTDDMFIDIGAKNKDDVAELGIEVGTPVTIDREFTELANNRVTGKAFDNRAGVA
MLIKTMQKMKSPFTVYAVFTVQEEVGLKGAKTSAYTIDPDWAIATDVTIPGDHPGIDMKD
AAVEMGKGPVITIVDSSGRGLIASRKVVQWLKNAAETNAIPVQYEVGTGGTTDATSIHLS
RGGVPSTTISPPTRYIHSPVEVLDTGDIEAGVNLLVAALKTKPAL
Download sequence
Identical sequences A7I7K8
gi|154150744|ref|YP_001404362.1| WP_012106750.1.2930 456442.Mboo_1201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]