SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_1634 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456442.Mboo_1634
Domain Number 1 Region: 469-703
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 2.62e-88
Family Type II DNA topoisomerase 0.00022
Further Details:      
 
Domain Number 2 Region: 293-466
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-52
Family DNA gyrase/MutL, second domain 0.00000984
Further Details:      
 
Domain Number 3 Region: 5-158
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.6e-51
Family DNA gyrase/MutL, N-terminal domain 0.00000927
Further Details:      
 
Domain Number 4 Region: 233-291
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000000000286
Family DNA gyrase/MutL, N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_1634
Sequence length 708
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MTDTYDASHITVLEGLQPVRERPAMYIGSTDTRGLHHLVYEVVDNSIDEALAGFCNRICV
VINKDGSLMVEDNGRGIPVDTMEKNHKSALEVVLTVLHAGGKFDKETYQVSGGLHGVGVS
VVNALSNWLSARVYRDGNIYEMRFSQGKTTLPLTTREETLAELLARYQQWYGEPAPFARA
SPALAVSSGAIPGQVPVTPPGTVTGQLDLTTAAHYPTGNEQEDRASLLATLGNKLTGTRI
HFVPDASIFETTTFDYDVLAHRLRELAFLNAGLTIIITDERTGDSATYCYAGGLSEFVKY
LNEGNEVLHPNPIYITKKDAENKLDLEVAMQYTTGYDEKLYTYVNSVNTREGGTHLEGFR
SAITRGINVVAKRNGIIKENAQVTLRGEDVREGLTSVVSVKMANPQFEGQTKMRLGNSSV
KGIVDSLVYAALTEYFDENPGVLKIIVEKALSAAKAREAARNARDLARRKSSLESAGLPG
KLSDCSERDPAKSEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKAGEHQILKNA
EIQTLINAIGTGIGEKFDPERARYHRIVIMTDADVDGAHIRTLLLTFFYRYMRKLIELGY
VYIAQPPLFRIAKGKEEKYVYKEAEMQKVSAAMGDKGVSIQRYKGLGEMNAQQLWDTTMD
PENRIFLKVSIEDAYEADEMFKTLMGKDVEIRKNFIMRHAKEVTNLDI
Download sequence
Identical sequences A7I8U0
WP_012107197.1.2930 456442.Mboo_1634 gi|154151176|ref|YP_001404794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]