SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_1953 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456442.Mboo_1953
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 8.33e-30
Family Ribosomal protein L44e 0.0000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_1953
Sequence length 92
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MKMPAKFKTYCPFCRNHQIHEVEKVKKSKTTGLHWIDRQKARRGKVGNMGKFSKVPGGDK
PTKKINVRYRCTTCGKAHLRKGFRVAKFELTE
Download sequence
Identical sequences A7I9Q7
WP_012107523.1.2930 gi|154151493|ref|YP_001405111.1| 456442.Mboo_1953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]