SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 458817.Shal_0624 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  458817.Shal_0624
Domain Number 1 Region: 22-294
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.82e-92
Family Methylenetetrahydrofolate reductase 0.00000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 458817.Shal_0624
Sequence length 296
Comment (Shewanella halifaxensis HAW EB4)
Sequence
MGFHHAQHATSLNQSLSELNGDINVSFEFFPPSTPEMEKLLWNSIRRLEPLNPKFVSVTY
GANSGVRDRTHGVIERIQKETDLVAAPHLTLVDASDEELKELAKHYWNSGIRDIVALRGD
LPEGSPKPTRFANDLVSLLRSVADFDISVAAYPEVHPDASNAQSDLIHLKKKIDAGANRA
ITQFFFDVESYLRFRDRCAAAGIDAEIVPGILPVTNFNQTKRFAAMTNVSIPSWLHRQFE
GLEDDPTTRQMVGANVAIDMVKVLSREGVKDFHFYTLNRAELTYAICHTLGVRPGK
Download sequence
Identical sequences B0TS64
WP_012275753.1.86919 gi|167622564|ref|YP_001672858.1| 458817.Shal_0624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]