SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 460265.Mnod_3756 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  460265.Mnod_3756
Domain Number 1 Region: 4-189
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.36e-50
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 460265.Mnod_3756
Sequence length 340
Comment (Methylobacterium nodulans ORS 2060)
Sequence
MSNRDIIVIGGSSGATAPLKMVLGALPENLPAAVFIVLHMPARSLGILATVVSAAGRLPV
RPAADGMAIQPGTIYLGVPDHHLILTEGMIRLGRGPRENMVRPAIDPLFRSAAAAYGPRV
IGLLLSGFLNDGTSGLEAIKRCGGLALVQDPLDAIADEMPRSALSAVSVDLTAPSARLGD
VLSDLVREKAGPRLPVPPEIRLEVDIAAGERVDSEVLRRFADPVALTCPHCSGVLSQVRG
AKPLRFRCQVGHAVTAEVAAKEQEAAIDEALRVALRIIEERAELVQRMAEDGRAAGRLAI
AEMYEERAIEYRRYADTIRRAVLLSLPERPVSPDEAEGPG
Download sequence
Identical sequences B8IRC2
WP_015930318.1.92880 460265.Mnod_3756 gi|220923663|ref|YP_002498965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]