SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 465515.Mlut_22150 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  465515.Mlut_22150
Domain Number 1 Region: 4-308
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.28e-102
Family Glutaminase 0.00000243
Further Details:      
 
Domain Number 2 Region: 320-351,400-444
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000173
Family Anti-sigma factor antagonist SpoIIaa 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 465515.Mlut_22150
Sequence length 456
Comment (Micrococcus luteus NCTC 2665)
Sequence
MRHPIPDYLASLITELGAVNPGETAQYIPVLAEADPDRFGIALATPTGRLHFAGDADVEF
TIQSASKPFTYAAALVDRGFAAVDRQVGLNPSGEAFNELSLEAESHRPDNAMINAGALAV
HQLLVGPQASREERLDRAVEIMSLLAGRRLSVDRETYESEMAVSDRNLALAHMLRSYGVL
QDSAGEIVAGYVAQCAVLVTVKDLAVMGACLATDGIHPMTGERVLPSIVVRRVVSVMTSS
GMYDAAGQWLADVGIPAKSGVAGGVLGALPGRVGIGVFSPRLDEVGNSARGVLACRRLSE
DFRLHLMDGDSLGGTAVRFVEREGDRVFLHLQGVIRFGGAEAVLDALTDLRTGAEKPGTG
WDAAVYPRWQEAAADSAALSAATGGGAVHEAAAVAAQDENDGPIRTVVLNLERVDWIDDV
GRRLIAEGVRRLQADGVRVEVEDPERILPLEEAGAH
Download sequence
Identical sequences C5C7J5
465515.Mlut_22150 gi|239918679|ref|YP_002958237.1| WP_010079902.1.25715 WP_010079902.1.54265 WP_010079902.1.79382 WP_010079902.1.79589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]