SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471854.Dfer_5177 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471854.Dfer_5177
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.58e-56
Family Methylesterase CheB, C-terminal domain 0.0000415
Further Details:      
 
Weak hits

Sequence:  471854.Dfer_5177
Domain Number - Region: 230-261
Classification Level Classification E-value
Superfamily YfgJ-like 0.0196
Family YfgJ-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 471854.Dfer_5177
Sequence length 345
Comment (Dyadobacter fermentans DSM 18053)
Sequence
MEKRNIIVIGASMGGFDALRKMFAELPADLDAAIFIVWHMSPFVRGVLPQTLNKLCGIPA
AHAFDGEPIAMNRIYVAPPDHHMILEDGMIRVTHGPKENRFRPAVDPLFRSAAYIYGNRV
IGVILSGALDDGTAGLWTVKYLGGLALVQNPLDAEVASMPESAIRQVKTDYIVPLAETAQ
LLVRLASEQVGEKKPAAMKEKEKTKAEIRMVTEVNPVGVDIKKFGQLSPYACPECHGVLT
LIKEGDITRFRCHTGHAYSSGSLLSSLTERMEEDIYGTLRGLDETIMLLNQLGDHFAEAN
HARLAAVYFRQAAHTAERAALIRQAAMLPATFEPIQQENQEQLPG
Download sequence
Identical sequences C6VSE1
gi|255038920|ref|YP_003089541.1| 471854.Dfer_5177 WP_015814617.1.10152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]