SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471857.Svir_24130 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471857.Svir_24130
Domain Number 1 Region: 214-359
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.97e-31
Family Histidine kinase 0.00099
Further Details:      
 
Domain Number 2 Region: 123-206
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.16e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0013
Further Details:      
 
Domain Number 3 Region: 87-136
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000445
Family HAMP domain 0.0085
Further Details:      
 
Weak hits

Sequence:  471857.Svir_24130
Domain Number - Region: 8-85
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0863
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 471857.Svir_24130
Sequence length 362
Comment (Saccharomonospora viridis DSM 43017)
Sequence
MLATTLVAIVSVALLWLAWRLVGDSVAAVPQLPPGTLVQVDGVDVEASVLAEHLREQAQQ
RMVAAAIIAFVLVVAAAGILAWTLTSRVLSPLREITDTARRLSVESLGERIGRVRSRDEL
AELASTFDAMLDRLQAAFDAQRHFVANASHELRTPLAVIRTELEVTLSDEDADVEELRRM
AGVVQDATERAERLVNSLLLLARTDGTELAVTEPVDLVDVVESAWSAVRASAERKDITTD
FQLERAVTVGDPALLERIAGNLLENAVTHNVEDGWIEVTTKPWEGPRVALVVRSSGGVIE
PETVEGLFEPFRRAGVARTARTGAGLGLSIVQAAVRAHGGTVRAEPVPGGGLAVTVVLPA
GA
Download sequence
Identical sequences C7MYJ0
gi|257056404|ref|YP_003134236.1| 471857.Svir_24130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]