SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471857.Svir_36860 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471857.Svir_36860
Domain Number 1 Region: 34-400
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 2.35e-26
Family Soluble quinoprotein glucose dehydrogenase 0.002
Further Details:      
 
Domain Number 2 Region: 402-485
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000903
Family PKD domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471857.Svir_36860
Sequence length 892
Comment (Saccharomonospora viridis DSM 43017)
Sequence
MAAVVASTALAASLVTVFATTVGSGAALAEEPRVPEGFALRESPSGQSPGDLTDFAYLPD
GSVLTTGKTGKVAWVSTDGHSRVLRSLSVESQQDMGLVGLAVASDYETSRHIYLARSVPT
GGGSYDLTLARWEVTGSPEPTGLTNETELLRLPGDANVHGITGIVADEDGTIWVSIGDVA
SYTEVDARALRAQKPYALQGKVLHLTADGRGVPGNPFYDPADPDSARSKIFASGFRSPFR
LSLDPRSGLPILGDVGWNRWEEINLVQPGRDYGWPCWEGTEGTPGYRELPECEDAPNTAP
LVQFRHGRDVDSANSVTGGVVYTGTSYPEEYRGAYFFGDYTHQKLWSLRYDDQGRLVRSP
ESPPLGTHIGRPVKFDTAANGDIVFADIGSGKLKRLTYTPGNQRPVAKVSLETDPETRTV
TFDGGESFDFDGDPLTYHWDFGDGTSDTGKRVEHVYDSSEERFTATLTVTDAAGASGTAE
VTVVPGNHTPRLRARTEEDRTYAVGETVSVSVWAEDDEDGLLDVSWQATVVHCPEDATCH
SHPSESGEGTRFSVPFTDHPDSHMELTATATDSEGVSSSYTFTALPREHRLTLSSNVPAA
VEIASEGDGDTSTRGGTAMVTAGATVSVAAAGTAADGESVFSAWENGASERTHTFTMPDE
EFTLTALYATPVEQRYANEPGLRDILGEPTGPVVIDGDVYYREHADGRLYWSAGTGTHEV
HGPIAEKYVELGGHKRFGPPTTDQTVTPDGRGRFNHFLGTPYTRAVSVYWTPETGAHAVW
GEIRKRWAALRWERGPLGYPTTDESRTPDGIGRYNHFSKGGSVYWTPRTGAHAVYGAIRR
HWASLGWERSYLGYPVSSEYSVTGGRRNDFQGGYIEWRAATDRTVDRRVSPS
Download sequence
Identical sequences C7MR50
gi|257057631|ref|YP_003135463.1| 471857.Svir_36860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]