SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 477974.Daud_0086 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  477974.Daud_0086
Domain Number 1 Region: 9-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.07e-60
Family PP-loop ATPase 0.000097
Further Details:      
 
Domain Number 2 Region: 369-462
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.54e-20
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.028
Further Details:      
 
Domain Number 3 Region: 214-318
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 5.49e-19
Family MesJ substrate recognition domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 477974.Daud_0086
Sequence length 470
Comment (Candidatus Desulforudis audaxviator MP104C)
Sequence
MDLQDRVQQYILRHRMLEPGMGVLVGVSGGPDSVALLDVLYGLRAVLGISITVAHLNHRL
RGAEAEADARYVRKLAEKFGLPCIVEECDVPTFRKAERLSIQTAARELRYEFFARAARET
GARRVALGHHADDQAETILHHFLRGTGPAGLAGIAPVRGLFIRPLLGIRRREIEAYCRAR
GLDPRLDPSNLDPVYTRNRLRAELLPLLETEYNPNLVTALLRLGEICRAENDYMEEQTET
IFRRSAAPTDGCVRLDADRVAALPPAIGRRMIRRAWSELAGDPGALDFDHVERVLELARA
AAGGKRLDLPRGIRVERQFAALVFSLGPDPAEYGAWHYVLVVPGRTELPEVGLLITTDIR
PAEQAWRPETLQPGQAAVDLDTLTLPLVVRNRRPGDVFWPQGAGGRMKLKEFLINNKVLR
PERDRIPLVFDGEGRLVWVAGYRIAEFCKLTPGTRSVLLLTVSEPGPGVV
Download sequence
Identical sequences B1I1P2
477974.Daud_0086 WP_012301248.1.36146 gi|169830304|ref|YP_001716286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]