SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 477974.Daud_1819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  477974.Daud_1819
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily AF1862-like 6.02e-28
Family Cas Cmr5-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 477974.Daud_1819
Sequence length 125
Comment (Candidatus Desulforudis audaxviator MP104C)
Sequence
MQTRNQEYAAKIFEQVMQVRDELGKDGSNNYGSLAHRLPVFVRTAGLAQALAFVEARDGA
AGRKLLRDIAAVVNEEELLARSRTAELPEYMLLTRNVLAALAWYKRFAQSVLGVEAGADR
EGVGE
Download sequence
Identical sequences B1I5K6
477974.Daud_1819 gi|169831965|ref|YP_001717947.1| WP_012302891.1.36146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]