SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 478009.OE2645F from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  478009.OE2645F
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.05e-40
Family GHMP Kinase, N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 191-303
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.32e-27
Family Mevalonate kinase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 478009.OE2645F
Sequence length 330
Comment (Halobacterium salinarum R1)
Sequence
MTTTSSAPGKVYLFGEHAVVYGEPAVPCAIERRAHVTVSEREDSRLRVCSGDLSIDGFTV
EYSGDRDAGGTPDVDVPAPIVDAAMGYVDAAVEQARAAADAPTAGFDVTIDSEIPLGAGL
GSSAAVVVAGIDAATRELGVELDAREVADRAYQVEHTVQDGEASRADTFCSAMGGVVRVS
GDDCTTLDAPALPFVIGYDGTSHDTGELVAGVRALREEFGFVADTVTAIGDLVRRGEAAL
ADGDVATLGRLMDINHGLLSGLGVSGRTLDAMVWAARDGGADGAKLTGAGGGGSIVALDA
GSGAETALSLTPDCEAAFRADLAREGVRVE
Download sequence
Identical sequences B0R4Z1 Q9HQI6
gi|15790225|ref|NP_280049.1| gi|169235954|ref|YP_001689154.1| WP_010902824.1.1784 WP_010902824.1.50382 478009.OE2645F 64091.VNG1145G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]