SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 478801.Ksed_20910 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  478801.Ksed_20910
Domain Number 1 Region: 8-284
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-106
Family G proteins 0.0000000254
Further Details:      
 
Domain Number 2 Region: 482-607
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-41
Family Translational machinery components 0.0000151
Further Details:      
 
Domain Number 3 Region: 267-407
Classification Level Classification E-value
Superfamily Translation proteins 3.79e-33
Family Elongation factors 0.0001
Further Details:      
 
Domain Number 4 Region: 611-698
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.68e-29
Family EF-G/eEF-2 domains III and V 0.0000879
Further Details:      
 
Domain Number 5 Region: 407-484
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.16e-25
Family EF-G/eEF-2 domains III and V 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 478801.Ksed_20910
Sequence length 702
Comment (Kytococcus sedentarius DSM 20547)
Sequence
MAQDVLTDLKQVRNIGIMAHIDAGKTTTTERILFYTGVNHKMGETHDGASTTDWMEQEKE
RGITITSAAVTSFWKGTQINLIDTPGHVDFTVEVERNLRVLDGAVAVFDGKEGVEPQSET
VWRQADKYGVPRMCFINKMDKMGADFYYSVQTMVDRLGANPLVMQLPIGAESDFIGMVDL
VTMKAFTWSKETPLGEAYQIEEIPADLQDKADEYRAALVEKVAESDEALLEKYLGGEDLT
EDEIRAGVRTLTLAGEVNPVFCGTAFKNKGVQPLLDAVVAYLPSPVDLPPIEGHLPGDEE
NVVLRKPSSDEPFAALAFKIATHPFFGTLTYIRVYSGEITSGSAVLNATKGKKERLGKLF
QMHANKENPVEKVSAGHIYAVIGLKDTTTGDTLSSPEKPAVLESMTFPAPVIHVAIEPKT
KGDQEKLSTAIQKLAEEDPTFTVNLDEDTGQTVIGGMGELHLDILVDRMKREFKVEANVG
APQVAYRETIRGTVDKLDYTHKKQTGGSGQFAKVQLKFEPLEQGDEDAALYEFENAVTGG
RVPREYIPSVDQGIQEAMQLGVLAGYPLVGIKATLLDGAYHDVDSSEMAFKIAGSMALKE
AVRKANPVLLEPMMAVEVRTPEEYMGDVIGDINSRRGTIQSMEDASGAKVVRGTVPLSEM
FGYVGDLRSKTQGRANYSMQFDSYGEVPKSVAEEIVKKVRGE
Download sequence
Identical sequences C7NKZ4
478801.Ksed_20910 gi|256825890|ref|YP_003149850.1| WP_015780022.1.81216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]