SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 479433.Caci_1303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479433.Caci_1303
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily YaeB-like 3.14e-37
Family YaeB-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 479433.Caci_1303
Sequence length 155
Comment (Catenulispora acidiphila DSM 44928)
Sequence
MTSFEVTPIGTVRNDRTDVQNSDNWGAVRSTIVVDERFGEACLQGLEGFSHVEVLFVFDQ
LAEREDYREPAPYRGRADLPPVGIFAGRGPRRPNRIGVTSCAVESVRGRELTVVGLDAVS
GTPVLDLKPVMAEFQAVDVRQPAWVSAMMADYFRD
Download sequence
Identical sequences C7Q7E0
gi|256390505|ref|YP_003112069.1| 479433.Caci_1303 WP_012785522.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]