SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479433.Caci_8778 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  479433.Caci_8778
Domain Number - Region: 70-198
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000183
Family Bifunctional DNA primase/polymerase N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479433.Caci_8778
Sequence length 223
Comment (Catenulispora acidiphila DSM 44928)
Sequence
MTVLSLPEGDLAEAGPAATDADPLGLKAAALNYIEERHWDILPGASVLRADGAWRCSCGN
TACPALGSHPAHRDWNKQITAQPSRVHSWWEEHPDSAILLPTGRTFDVIDVPEQAGCLAL
ARLERNGAALGPVAATPTRRLYFFVLPGTKKKIPEMLVRAGWGRAQLDLICHGEKGFVVA
PPSRMGTGGQVQWARPPGESNRWLPEAAELIPTLAYACGRERY
Download sequence
Identical sequences C7Q256
WP_015797317.1.73754 479433.Caci_8778 gi|256397870|ref|YP_003119434.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]