SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 480119.AB57_1038 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  480119.AB57_1038
Domain Number 1 Region: 4-304
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.15e-109
Family Glutaminase 0.00000244
Further Details:      
 
Domain Number 2 Region: 327-398
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000255
Family Anti-sigma factor antagonist SpoIIaa 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 480119.AB57_1038
Sequence length 426
Comment (Acinetobacter baumannii AB0057)
Sequence
MKTPLPDYLANVIEACDIDNSGHLADYIPELANANPNRLALAMSTVDGEIYSVGDDDVEF
TIQSISKPFVYAYVLQQLGIDAVLAKVGVEPSGEAFNEISLGKDGRPKNPMINSGAITVH
SLIQVKHGLHSAEILRRFMSELAGRELSFDESVYDSEVKTAYRNLSIGYMLRTVGILETD
PVDIVNGYIRQCAIMVTVKDLVRMGSVLANGGVDPKTGKRLLNRSVVRQVLSVMMSCGMY
DAAGDWLSTVGIPAKSGVAGGILGVLPGQVSIAAFSPRLDEHGHSVRGIDILERLSRDMG
LHLMEGTPSAQTIVQSHYRTGKDASLSVYVLRGVLKFTEAEMLLRILQDETTDQSTIVID
LTQISLIHDVGKRMFLEGVDRLIDDGHTLVLVDPEQRLDHARTAKDRELHVYHDFDDLLE
KHEIRY
Download sequence
Identical sequences gi|213156767|ref|YP_002318428.1| 480119.AB57_1038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]