SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 480224.Chy400_1929 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  480224.Chy400_1929
Domain Number 1 Region: 228-337
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 480224.Chy400_1929
Sequence length 342
Comment (Chloroflexus Y 400 fl)
Sequence
MQTSQSLLDQFFRQIARSIALGIGVIAAVVVPIELISFVLTNNTLLAIAAAISTTIGIGS
GCTVFLLDRGQPLWQGILPFAVLIVVAEIMVALWLPELYVSAAPFIVVAILLASLINRRV
FTISVLVICIVVTVVLLLISQPAPEAKIPAPMFSFLQASSLAALFVAVWIFLDRIIAAQM
QALQIADQRADDAEAARQQTELARQEVERRASEQQRLLELVAVLELPILTIDDRVLLAPL
VGNLDSRRADALRQRVLERLAELRAHTVIIDITGITVIDTAVAKALIDTATAIRLLGART
IISGIRPTVAQTLVHLNTGLHEITTAPNPEAALRLARPAVMI
Download sequence
Identical sequences A9WD32
324602.Caur_1782 480224.Chy400_1929 WP_012257653.1.35445 YP_001635388.1.55443 gi|222525190|ref|YP_002569661.1| gi|163847344|ref|YP_001635388.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]