SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 480224.Chy400_2551 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  480224.Chy400_2551
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.09e-56
Family Ribosomal protein S7 0.00000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 480224.Chy400_2551
Sequence length 157
Comment (Chloroflexus Y 400 fl)
Sequence
MPRRGNIERRPIPPDARYNSVLVQKFINKVMERGKKSLAERIVYQALDLAAERLKKPQME
IFEQALRNASPSIEVRPKRVGGATYQVPVEVKSDRRYSLAMRWLLMSARARTGKPMVERL
AAELIDAYNNTGTTIKRKEDVHRMAEANRAFAHYGRL
Download sequence
Identical sequences A9WH61 B9LJC7
324602.Caur_2364 480224.Chy400_2551 gi|222525798|ref|YP_002570269.1| WP_012258227.1.35445 YP_001635962.1.55443 gi|163847918|ref|YP_001635962.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]