SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 484021.KP1_0811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  484021.KP1_0811
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily ITPase-like 3.84e-56
Family YjjX-like 0.000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 484021.KP1_0811
Sequence length 173
Comment (Klebsiella pneumoniae NTUH K2044)
Sequence
MIMHHVVSATTNPAKIQAILQAFDEIFGEGSCHIESVAVESGVPEQPFGSEETRAGARNR
VANARLAQPNADFWVAIEAGIDDDSTFSWVVIESASQRGEARSATLPLPDVILEQVRAGE
ALGPVMSQYTGIDQIGRKEGAIGVFTGGRLTRSSVYHQAVVLALSPFHNAIYR
Download sequence
Identical sequences A0A060VIS2 A0A0E1CJP0 R4Y5A1 W8VI42
gi|238892980|ref|YP_002917714.1| 484021.KP1_0811 gi|529986522|ref|YP_007989908.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]