SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485915.Dret_1392 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485915.Dret_1392
Domain Number 1 Region: 6-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.73e-24
Family Anti-sigma factor antagonist SpoIIaa 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 485915.Dret_1392
Sequence length 114
Comment (Desulfohalobium retbaense DSM 5692)
Sequence
MEKTVIEQRNGVCQVTYSGELTLEVTSQLKERIEQALENEHCQALVMDLSETVFLDSSGI
GFLVSLNKKMRQQDNTFYLYRPSSQVRKTLSLVKLLDYFHIAESEEELPEGITV
Download sequence
Identical sequences C8X2N2
WP_015751826.1.45754 gi|258405515|ref|YP_003198257.1| 485915.Dret_1392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]