SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 485916.Dtox_2976 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485916.Dtox_2976
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily AF1862-like 1.05e-38
Family Cas Cmr5-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 485916.Dtox_2976
Sequence length 133
Comment (Desulfotomaculum acetoxidans DSM 771)
Sequence
MSKTLEQERAADALQKVKEVRQERKDLLIEYSSYAKSLPATILANGLGQAAATLLAKAKD
NKKDAHYILYTHLREWLCSDREVVPYNKGEDLMEAITSNDRNAYIRAQAEALAWLQWLKK
FAAAYLHNPEGEK
Download sequence
Identical sequences C8W2P6
WP_015758422.1.30109 485916.Dtox_2976 gi|258516131|ref|YP_003192353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]