SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 485916.Dtox_3350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485916.Dtox_3350
Domain Number 1 Region: 50-271
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000000264
Family Phosphate binding protein-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 485916.Dtox_3350
Sequence length 364
Comment (Desulfotomaculum acetoxidans DSM 771)
Sequence
MRLHKRTLVIIAAFAIFIITPALYFYFNKLHKTAAADTLPVIEDCRSLSGLPQYIAMKKG
YFEEQNLKIELKTASTSQELHEAVKTKKRSIVLCGSETIVNYLSQDSCNMMVFAGLTDRE
DSFLLGRPDVSEFTKEKVRGNSIIVSSPDSLQSMVLENILREKKIWPNYEVNLMQNLPDN
LKRGAFKSGTATFIVLTEPEATLLETAREAKTLLAFAAAGGELPAVVLACDKQLLLSKPQ
TVQKYTNAVYKAILWINCHNTGDIVALIKEFYPNTDQKLLISAVNRYKDLSIWTETPVIT
QKSYENLLNIMENSGELTRPKKYNDVIDNRFATEAVQSITYTPEEEQKKGFFNTIFKHFN
FWQR
Download sequence
Identical sequences C8W5T0
485916.Dtox_3350 WP_015758770.1.30109 gi|258516481|ref|YP_003192703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]