SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 485917.Phep_3092 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485917.Phep_3092
Domain Number 1 Region: 123-274
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.09e-40
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00063
Further Details:      
 
Domain Number 2 Region: 396-560
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.42e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 20-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.24e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.013
Further Details:      
 
Domain Number 4 Region: 255-278,308-410
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.65e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 485917.Phep_3092
Sequence length 697
Comment (Pedobacter heparinus DSM 2366)
Sequence
MQSFRTELENPIVEKDIIDLEKKIRAFREGKIHDEKFRSLRLARGIYGQRQPGVQMIRIK
LPFGKVTFKQILRISDVSDKYASRNLHLTTRQDIQIHYVSLDRTPELWEELEQDDVTIRE
ACGNTVRNVTSSPDAGISLNEPFDVSPYAHAFFSYFLRNPICQEMGRKIKFSFSSDERDT
AFSYIHDLGFIPKINEKGERGFKVLLGGGLGAQPFLAELVHDFLHEDQIIPYAEAMLRVF
DRYGERTNRNKARLKYLVQKLGLEEVLRLIEEERTANKVKSFKIDRDAVPQPAVPELIDY
PVLDEVKESLDYKHWRATNVTPQKQEGFYAVYIKVTKGDIPTEDARKLIEAIRPYVADEI
RVTQNQGLMLKFAREAALPGLYVALKELGFAKPGFDSVADVTTCPGTDTCNLGISNSMSL
SVALEEVIYEEYPELIYDKDLKIKISGCMNSCGQHGLAHIGFHGSSVKANGKVVPAVQVM
LGGGTVGDGEGRVAERVIKAPSKRATDVLRYLLNDFAANSLDNESFHAYYDRQTKDYFYQ
LLKPLADLSNLKDEEFVDWGHEETFVTAIGVGECAGVVIDLVATLLLESDEKLEWAKASY
SAGAWADAIYHTYAVYVSAAKALLLDKGVNSSTQIGVIREFDNHYVQTGEVKLEGSFNDL
VLQINKNEPTEAFATAYLKSLEDFYTGIKSQREEKVS
Download sequence
Identical sequences C6Y364
485917.Phep_3092 gi|255532979|ref|YP_003093351.1| WP_015808898.1.64783 WP_015808898.1.66710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]