SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 485918.Cpin_4423 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485918.Cpin_4423
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.88e-56
Family Methylesterase CheB, C-terminal domain 0.000043
Further Details:      
 
Weak hits

Sequence:  485918.Cpin_4423
Domain Number - Region: 218-261
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0272
Family Cytochrome c3-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 485918.Cpin_4423
Sequence length 347
Comment (Chitinophaga pinensis DSM 2588)
Sequence
MNNRKIVVIGASAGGFEAIKKIVSDLPANFDAAIFIVWHMAAEVRGILPEVLNKLGTLPV
AHAVDEESVIGRRIYIAPPDRHLLLGKGKVRVTRGPKENRFRPAIDPLFRSAAIAYGTQV
IGVVLSGALDDGTAGIWAVKQQGGLAIVQDPDDAEVSSMPVNAMNAVKVDHIAPVSEIAA
LLVRLANEEIPSLNGRNAEFVTTAQQEVGIAMKDENISREVFRHGELTPYTCPECHGVLS
SLTEGDRIRFRCHTGHAFSADTLLSAITESIEEALWNAIRNIQESTLLLNHMGDHFAEAN
QAKIAAMYFKKAKDAMKRGEMVRKAVFDHEQLSMDSVKDQADTENVA
Download sequence
Identical sequences C7PHZ5
WP_012792035.1.2976 485918.Cpin_4423 gi|256423415|ref|YP_003124068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]