SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 485918.Cpin_6455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485918.Cpin_6455
Domain Number 1 Region: 72-390
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.51e-87
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 485918.Cpin_6455
Sequence length 392
Comment (Chitinophaga pinensis DSM 2588)
Sequence
MEKQLSLSFENTAIAFESKTDKALKKADFLFTNIGKPWLVKVGAAVTPFALKIGLPIKGL
IRSTIFSQFCGGENLQEAAATASSLGKFHVGVALDYGVEAMEGEENYDHAVPEFVRAIEY
AAGNPNIPFIAIKVTGFARFSLLEKLHANETLTPEEAAEYARVRQRIQTIAATAAKHKVG
LLIDAEESWIQQPVDDLTEELMAQFNTTNAIVYNTFQMYRHDRLAFLKRSFEKAQQQGYL
LGAKLVRGAYMEKERKRAEEMGYPSPIQPDKEATDRDYNAAVTFCMERLDKLAVFVGTHN
EQSSMLAASLLHQQELPHNHPHVSFSQLLGMSDNITFNLAHAGYHVSKYLPYGPVKDVMP
YLLRRAQENTSISGQVGRELGLIRKERKRRGI
Download sequence
Identical sequences C7PKU9
485918.Cpin_6455 WP_012794023.1.2976 gi|256425407|ref|YP_003126060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]