SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4959.Q6BJ91 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4959.Q6BJ91
Domain Number 1 Region: 256-477
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 6.48e-45
Family ATP-dependent DNA ligase catalytic domain 0.00067
Further Details:      
 
Domain Number 2 Region: 486-622
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.11e-22
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.003
Further Details:      
 
Domain Number 3 Region: 644-759
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000552
Family DNA ligase 0.053
Further Details:      
 
Domain Number 4 Region: 830-939
Classification Level Classification E-value
Superfamily BRCT domain 0.00000407
Family DNA-repair protein XRCC1 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4959.Q6BJ91
Sequence length 941
Comment (Debaryomyces hansenii)
Sequence
MSYLDDIERPKNELNDASFNFLVEQLFSKLDVVSSEHLGPFPNVTSKKNFIIESFIQQWK
QFIGNDIFPAARLIFPNRDKRLYFIKDVVLARLVIKMFNIPKNSIDYDKLFNYKKHYHDY
MHLNRYANKHLRSLPLIISQIISERRDPSKIVKSTFTINQINEILDELCSPEATKSEIQI
GILKPVIEKLTIEEIRWFTTMILKKSILASFEVIFFRAWHPDAPRLFNICNNLSKVFWLL
TDPEKRLDPDQLNVQLMYPFLPQLSQKLSISYDQLCNKMNNEFFIEEKMDGDRMIMHMEN
NKFKFFSRRTKDYTLLYGSNLQIGSLTKHLRDAFDPKVKSIILDGEMVAWDYKRNLILPF
GTLKASAVQEAVRQFTTTDVFEQQSSWPLFIIFDILHLNGKDLTRYPLFYRKDLLHKVIN
PIPHKFEILQFIKCKDANDIKLAIRNIISERSEGIMVKNTKSNYHVASRNNCWIKIKPEY
LEQFGENLDLVVIGIIPGIKNSYICGLRDSDDNDIFKSFCTVANGFSENEFNKIERLTTG
KWVEYKKRPPPDDLLKFGTKKPTSWIHPNESVVLEIKARSIDCTYLSTYAVGTTLHNLYC
RGIREDKSYDECITLNEYKEIKLKYSSEFNKSQSIVKNRKRFINSFEEKLTNDKRRQIEV
ISKLFGNFKFLILSDKLNLTDNERISILEIGKTIKRYGGAIIHNPLNQSGDKQIVTLSEK
LTTKCEIYLKKGFDIIMPEWVFECIRRNSIVPLEPSFILDSINPTIVENARNQVDGFGDS
YVINVREPVFTFVQRLKIPHSLSKEKFHEYTDDFINELNRQDISLPIGFLFYNINFYLVD
ATTVCEWQSKILERKIERFQGKISSHLPECSFIIVSNASNQDSSLRDDLLSRVNSLSKEI
SQSVDFGTQGMSKIPRVVNETFIDQCIKYNVLVDPQDHLFV
Download sequence
Identical sequences Q6BJ91
4959.Q6BJ91 XP_461730.2.41535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]