SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 498761.HM1_2023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498761.HM1_2023
Domain Number 1 Region: 72-265
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.44e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00076
Further Details:      
 
Domain Number 2 Region: 375-453
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000038
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Domain Number 3 Region: 6-71
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000196
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 498761.HM1_2023
Sequence length 454
Comment (Heliobacterium modesticaldum Ice1)
Sequence
MACGMAELQQLISERTGWRFDQSRRDNLLQVLQARMEAHGIADHEAYHRLLLDKGPAGTE
EWRRLIDAVTVGETFFFRDRGQFALLRERILPTLLAERRDKKALRLWSAGCSTGEEAYSL
AILVDELVGAAPGWTIDVIGTDINEASLHIARAGRYSEWSLRATSPERRQEHFRRVDPGR
GRRAGPVWEVDPAIRSLVQFYRLNLLDGPLPDRFAPVASTDLILCRNVFIYFRPEAIRQV
LTDFFRCLNPGGFLLTGHGELLGLEPGQALFSFEHLLFPEGHIWQKPVIPPPAPSSRGIP
PAAVTQPLPGALSPERQPDRIPFQPPMPAMPKRAQSALGQAPLLPRDLPPQKPAIANVAG
EAPKLSDLDRLRDKARDFANRREYDRAEACCRAVIAVNPLDSEVYYLLGLIRLEQGDWSG
AHAFFQKVLFLAPDHGPARIEMAHVRLLLKENDQ
Download sequence
Identical sequences B0TG84
498761.HM1_2023 gi|167630092|ref|YP_001680591.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]