SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 500485.B6GW65 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6GW65
Domain Number 1 Region: 82-122
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000000406
Family Zn2/Cys6 DNA-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 26-73
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000034
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 500485.B6GW65
Sequence length 405
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MASLGNEIDLPLQSPIEVNSPTFRCHFPGCNASYRRKEHLHRHEGKHSQQQAFPCTNCGR
EFGRSDTLRRHVRQRHGIIEPLKRAQRACESCHAGKSRCEGGVPCNECIRRKIPCSFDDP
TSTVEDQSPGSGTHRASSVRHDQPRLQNTEKTEQCIRLYFEAFHPSWPFIHKATFDIRQE
TPLLVQTMVVIGLWATREQSAQSAAVELHGKLDSALRDQKEKWDASEAARAGSTCVWPIP
TYQAVLLHIIFSFVISNRDAIDFDLKISLSPADLGLLEALVRSCRRLGMFYYPNILAKYD
EGDLDSFVWVGTEEIKRFNIALYKVCGKASSSSIRDGIHVDANAWSSLTAGELQFPLPSN
CALWNAVTRDEWEAGAKDEKWVSLDDDRQKDWISNFAEILQVFEF
Download sequence
Identical sequences B6GW65
Pchr_Wisconsin_54-1255:Pc06g01890.t1 500485.B6GW65 XP_002556794.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]