SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 500485.B6H7H7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6H7H7
Domain Number 1 Region: 18-160
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.53e-21
Family N-acetyl transferase, NAT 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 500485.B6H7H7
Sequence length 226
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MVDIVPLSSYPSYIDLLPSIQTCNITNLPENYFLKYYLYHALTWPQLSFVAVVREYPKVV
GYVLAKMEEEPTDGLQHGHITSLSVMRTHRRLGIAERLMRMSQRAMAESHRAHFVSLHVR
MSNVAALRLYRDTLGFEVEKVEDGYYADGEDAYAMRLNLQSMWLDWKAIEKRDAENNKEK
NGEEGNEDEGEEVGDLGKKDAEKMIRVKVGRGLGVGDLVEKNESKA
Download sequence
Identical sequences B6H7H7
jgi|Pench1|86348|e_gw1.10.127.1 500485.B6H7H7 Pchr_Wisconsin_54-1255:Pc16g06600.t1 XP_002560996.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]