SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 500485.B6H9H6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6H9H6
Domain Number 1 Region: 15-64
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000787
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 73-114
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000576
Family Zn2/Cys6 DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 500485.B6H9H6
Sequence length 958
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MNSDHSPTHRGGLIQCDVCQATFTRQEHLNRHIRSHTTEKPFQCLQCGKSFTRLDVLHRH
NQSHVSKPLGDRSGKKFRACKECAVSRVRCSRGDPCERCSQREIQCIYPVAEKRKTQSSL
DRRHSSPRPTTSISSSAPGSPANSSQLEPSRPPVDSAGVSAPSTAPHTLGLDPGMQPLNP
LSSTSDSTNHWGWLPLQSSGTLPGASTEVINGNMPVFDSQILEKDLNEWVGNMASVNWLS
PQGPDFFPDAQLDDLLLLGISAGVAGQGETVNGLENYGLEKTNDAPPLLENSNVASVPAL
PHQFSGDQQTPVMEPVHSASGETTADTPVSRPPEGTYYVEGSAGRAPFQGKSSWRASRYS
PWGSNLGSTGRRTPVSERAESSCGLFVSEMVYKDCVRSFAAEANRLEIGPDMASIPSLGE
MQDLVQLYFVGFHPTYPFLLKHPSIFIPSSHWILLLAVAATGSRYSSKARYHLLGESLIY
VVDQILCNRLNNPVVGDGNQLWNPVPEVEEKRALDFVTLQAALLNYLSLLHCGQNGAVQR
ALNRRYHLIEAYRSLNLLSVAGKPSSEIRGEADPEDVFRHWLDSESLIRTGWMIWLLDSI
TSYQFHCTPLVHLGEVKARLPCREDIWDISSSPEPGCNLNCQSVTLLEALEMLYMEKKLP
PNLGDLSSSVLIFAICRRNQEASAQHQTELTFWSPNAEKQPRQIPRPTEETWPPAIPSLS
KWRNSACDCFDILHWNANSIAARVGGWEHPTILHLHIARLMLLAPVQHIQKLAVYPLAPL
TSPNSIPAAHMTARYHTLRWAIRDQYKARLCIVHAGALLWHVRRYSSNSFLEPFGVYAAT
LIIWAYSISMQTMRKSEDSDCETEPTVIQLDRPCDDEIVQAYVRFGHNMSARMHRVGDIC
EASAPRRILKQGIRLLTSDVTDPDGVRPGWGVEKSYIDSLNTFITSPVVSQKNDHLSP
Download sequence
Identical sequences B6H9H6
Pchr_Wisconsin_54-1255:Pc16g05230.t1 XP_002560867.1.37043 500485.B6H9H6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]