SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 500485.B6H9K6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6H9K6
Domain Number 1 Region: 16-92,126-196
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000886
Family N-acetyl transferase, NAT 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 500485.B6H9K6
Sequence length 275
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MAVASVPITHGGSSMLKSVAALNGRAFDTDPVIAYMLLGMSQQERLAYLPTYWTALVKSA
LLNHAVITEADGWKAASVLIPPGGYIENVWTLLWAGFLGVLWKIGLPGVKRLWTEFSGMT
DNAKKNGLRGHTQYYYVFSIGTEREHRGKGLAKAIIQEHQKTAQAANLPIWLEATTTGSR
ALYLSMGFKEVEEIRLGKGKVAADASIQPHGPGVTLWAMVSFYLSIRLLLAYSNNSTNST
KKKHSPQETLCKLFKALRIRPALILPVRSVIILSL
Download sequence
Identical sequences B6H9K6
500485.B6H9K6 Pchr_Wisconsin_54-1255:Pc16g11150.t1 XP_002561420.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]