SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 500485.B6HKE4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6HKE4
Domain Number 1 Region: 38-87
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000134
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 100-143
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000131
Family Zn2/Cys6 DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 500485.B6HKE4
Sequence length 1035
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MLSGKDNPEDSPGETHGRSEVRQDTDQNADELMAGHIQCSVCSSTFRRPEHLKRHLRSHT
KEKPFECAQCGRHFSRTDTLHRHELSHHAPGSGGKDRTHRITVKTFRACFSCATARVRCS
GGTPCGRCDTRSLGCEYPTQRRSKAKDMRDSGQEAETHNDNLKHMHQDLNAAAGQSQFSI
HMQNEPASSRTLLNVSSTPGNDHAKRKPQNAHTIADASNPRFYIPNEIRGQSETLPPGIY
PGGIKQTYDHSSSDIPKVFPVNSSNNLDSEMRDIQPGMNTAGDIEMTMANNPEVPLEFDP
TLFDQSMLSTVNWLPSDLLPGDPNGHAHSAGAASQYNQSLSPNAYFSRAAWQPPVINAGQ
VGSLQPERASQTPSVHVSLRNNMGSPNQYSHGISEPSPHTESVGSAMGSADYYVDGAPSR
LPKHGKKHTPWPGEYVERVDIGKQLLVEDDEHRFDFPIVSELRPDQTPEDITRFTQRIET
TIYDEIYRHFVQLCRTETPFFEVFESERFPTADECNQFTILFFNSFQAVYPILHLPKFDP
NTSHWLLTLSIIALGCHVSHISEMEQCTAALHELIRRGIYLEKEKSRSGQASLEILQAML
FNCIGLLHSRSEREKASALSTFGDLVTLMKSSRLLAPTRTKPNEASQDAAWASWIQDEVR
RRTGYCIWLVDCTLAYYFDNRPLLSLDDAQAALPAHEKLWQASSAETWKPLWAKSFGNSY
PDQKTDQTPTYTANESLYDAVHILYIEKRVVSGIGEFGHILLIHALYHRMWEVGDYFRRP
LSFWNPTAKKQSCETAIPTGSVWLPGIPSYSKWRNSACDCLDILHWTANSTVAKAAGLEH
PTILHLHTARLFLLAPFREMRSLATSLATEKQRWSKRHQTLEWQYIWRWMKHDQYKARLS
IIHAGVTLWHIRRYSTNAFHEPVAAFIAVLTLWAYGSCHPHTSHESSPRAEQLREPSFIH
LDRPCDDELVQLFVREGHTMRGNVTGVGDICGAEGPERVLRVGCEILSGLTAWSVSKKFV
AILTRLAELSSYSSS
Download sequence
Identical sequences A0A167TNU5 B6HKE4
Pchr_Wisconsin_54-1255:Pc21g07180.t1 500485.B6HKE4 XP_002567759.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]