SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 500485.B6HQ72 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6HQ72
Domain Number 1 Region: 480-752
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.94e-103
Family N-acetyl transferase, NAT 0.000000114
Further Details:      
 
Domain Number 2 Region: 152-215
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000125
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 500485.B6HQ72
Sequence length 1096
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MAATAPPANDESGKLDPPVDPADSDLDAEGEEETDLYEMDQRLQDAVHRAYTGEVDEDGP
EEAVDGNNLSVNGLNGEDDDDNDEAEPVGAVKLPDDDAGSEEDYAESETADADADPGFEA
NDRDASEPESSDHESEAEDWEAESNEREDVETDIRSSSNCLVCSQDEEHDPSEDFEEWLT
CVVCGDHSHRQCAREQDAFDETEGPWRCPSCVNNNLEPDTITNSATETGLGAPALPKELL
PAHAGTHDEGFHSIFNTGVDDEMLNSSRSLRKRKASSIEAEEHTPVLRKRLRQTSFRSDR
PILNDAALEGGDVNADGDAHSPARTRSVRVRRTRAVDREHCRVVARQYGKLIIGFRLEEA
KMSKITGSQIRSQRKKKKAPKPPPVAPEPQAHFVPLPPISYNSMTLFDRETDDAKSKPYG
GILSEVDQDTSRTLPTQFDRDRFEQARLKAEDEWQQKVKEAELNGETTAHSSQKVSGPPS
KIKSINFGGYEIETWYAAPYPEEYSRNRVLYICEFCLKYMNSDFVAWRHKLKCPAKHPPG
DEIYRDRSVSIFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVMTEFDDLGCH
FVGYFSKEKRPSSANNVSCILTLPIHQRKGYGNLLIDFSYLLTRIEGKNGSPEKPLSDMG
LVSYRNYWRLILSYQLRDLKTPISIADLSDRTGMTADDIVSALEGLRALVRDPITKTYAI
RLDHKYYNEVISGWESKGYVQLNPDALLWTPYIMGRSNQSHFDRAPIHTVAPREDPDEDE
EETEARVTDYEGNGRMANASDGDTLADSAGPPSTLALRHNGSNHPTVGNSETSAIPNPAA
GIPPSRFELWPPVPPAAPPKRRPGRPSGSTKLNSMSTTPTSARNNGRNTPRRPSGLATVT
PGGSVRRGRRSILTDSPAAEATPSQANGVEPEKTEPVEEEAVVDGDAENLAPELRETADV
SEKEPEHVNGDAAPKKPVKTNGIDAAESEPSEDKDTEAPKTPEKKTNSIPRSPGTAVSRR
SNDNPKTPRSVSRKALVEKVHVVIPAESGSASKSPAKGQGQKAMANTNGTDADSDADADA
DIDAEYEVDGDVVMQT
Download sequence
Identical sequences B6HQ72
Pchr_Wisconsin_54-1255:Pc22g06860.t1 500485.B6HQ72 jgi|Pench1|82359|e_gw1.5.1121.1 XP_002564713.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]