SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 500485.B6HQH6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6HQH6
Domain Number 1 Region: 60-98
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000406
Family Zn2/Cys6 DNA-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 4-43
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000243
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 500485.B6HQH6
Sequence length 399
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MAQFQCQVPGCTSSYRRKEHLRRHEAQHRGNHLRTCSVCGRAFSRSLRRHIRRDHEVPGR
SLARATQACRSCRMAKTRCQGGSPCTECSLKGNLCIFDGRDLPDIEPALPDPEEELLEYG
GENDPINTSLENNPRVDHYIHLYFAHFHPHWPILHRHTFSVPDEPPLLLQAVLMIGLWVS
GSPAARQNARNLHSKLGMAISAQRDNWGRLPVEGEHDNEDSGSPISRWPIATYQGILLYI
IFSLLASVPIGLELNLCLTLHLPDRQILSALIETCLRNNIFYYPNMLTRYHYVESITCMW
VGVEEIKRFGLALYKVSRLCGRGSCLGGSDETDGRLLRLSDLQFPMPDKKNLWHAGSNAE
LARLLLIYSRREDKSDDPRGTKWISQSGVLLETDENWWN
Download sequence
Identical sequences B6HQH6
500485.B6HQH6 XP_002566319.1.37043 jgi|Pench1|33733|fgenesh1_pm.2_#_1120 Pchr_Wisconsin_54-1255:Pc22g24310.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]