SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 500485.B6HVP2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6HVP2
Domain Number 1 Region: 2-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000197
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 64-104
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000198
Family Zn2/Cys6 DNA-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 500485.B6HVP2
Sequence length 619
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MFQCTLCEKAYQRKTHLIRHEATHTQLPSSSCPLCGKAFVKSEVARRHIKTCAKKFNQPA
PPAAKPGRKRHSCEPCFFAKVSCDRNSPCSRCLSLGRQCTFVTQEVPSGDPSCSTVTSLS
PSITVSRATSRDSGLFSFLQHFADPSFQRDRLAIGETAKCSVRRNLETLNSHIEDALVPT
YPMSAFGGDFQLTSSPFQIPSTLPSFTDDYLLQFSPDTLFPSKLSNQLSEIMTELVDTSK
SMGLGTAGTLNPLDTMELSTLLGVSNISASISAFFHSLHWHLPVVHFPTFDPGNISNPLL
LSIFLSGATYTIPLDGGALPSGLFDVAEEYIFRKIADLSTVASKDQSHLLSTVQLLQSAL
IIEMLQFGQDNMQTRRRIRIVRHPCLVSTIRSLGIFQLKRGTAPTVCDERTWRNLVAEET
CIRIACWVFLADGFLTVCFKNHPSISVFEMDCHFPWSAGLWEAENASSFSRIAMSHSTEL
PLPPLKDVVTQLLETPLSNDRIPWGLSVSVEHLLILIYAINSLAFQARAGLLRYLSLDRI
RCASGNWKLIWDSVIGLLDKDQFLHLGYPKHAQELWWLLNATLDATGRSDVSLRYMDNTA
TDDLGNLNEFIQWCHQAPS
Download sequence
Identical sequences A0A167VZ02 B6HVP2
XP_002565441.1.37043 Pchr_Wisconsin_54-1255:Pc22g15230.t1 500485.B6HVP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]