SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 504474.cur_1153 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  504474.cur_1153
Domain Number 1 Region: 5-312
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.42e-103
Family Glutaminase 0.00000232
Further Details:      
 
Domain Number 2 Region: 334-406
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000589
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 504474.cur_1153
Sequence length 412
Comment (Corynebacterium urealyticum DSM 7109)
Sequence
MKRHMVHGYLQEILEELKDSDGGEVADYIPQLATADPAPFAVALATTDGAVYSAGLNEGD
DELEFTIQSASKPFVYAAAIQERGLKKVRATVGMEPSGEAFNELSLDPGSNRPMNPMINA
GAIAVNQLINGEDSTVEERTEVIRQFLSELAGRDLEIDYLVCDSELEVADRNLSIAHMLR
SHGIIEDMAHDAVESYTQQCSIKVTVRDLAVMAATLASGGIQPLTGKRVVSPLVSRQVQA
VMSSAGMYNLAGRWMSVVGIPAKSGVSGGIMGTLPGVMGLATFSPRLDSTGNSVRGVKTF
HRLSEDMGLHLMGLRQRGDTAVRDIITREDGPNGRTTTIELQGIIDFAAAENAWRTILQE
EKLADRVVFDLSEVASVNDIGRRMVVQGFQGLRTAGRNVILKDPRKLFPELS
Download sequence
Identical sequences B1VH72
WP_012360401.1.62580 WP_012360401.1.83933 504474.cur_1153 gi|172040833|ref|YP_001800547.1| gi|448823805|ref|YP_007416971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]