SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5057.CADACLAP00001381 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5057.CADACLAP00001381
Domain Number 1 Region: 35-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000499
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 2 Region: 98-142
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000641
Family Zn2/Cys6 DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5057.CADACLAP00001381
Sequence length 1055
Comment (Aspergillus clavatus)
Sequence
MSEAANRHEADSVADNTSNKPDSEVRLSSTLGQTECSICHSTFRRPEHLKRHFRSHTKEK
PFECVKCGRHFSRTDTLHRHELSHHTLGPEGGKDRMHRITVKTFRACFKCAVARVRCSGG
SPCVRCQNRSLECQYPTERRSKTKSRKQAPQRSSPSEENALHGQASQHGSPPSPAVVHAN
REETRDNSRNEPPRFQITEFQLDITGSNWTTGTSSGDRIVVRDSQANSRDERVTVRDGPA
TTEAENLGTPLLLQNAAGSADEARTNFPPYSGFNAQQVYPYLPTSGVESAFPPGSAPPVG
HQTRDHQPEGAASSNLTLEMPAVESHQFQLGLDPPFLDQSMLSTLNWLPNDMFPDTLSNR
SLSRPPPISDQLDALDNSPNRPAWLPPVVNTHRISSSGREDLPQTSSRLISLDPEVGTPD
HLARSIGEVSVHSEPSHAAKRSADYYVDGAGARLPKYRRKRDSWSGSSAEPINILSPLHQ
SDTPLQFSFSPVQEARLDTISAEDTNPNRQIEPLAYDKIYQSFLQLCRTDNSLYPKFHSG
NFPSAAALSSFIYFYFDSFQPVYPIFHPPTFNPNNCHWLVTLAVSAIGCRFAGLTTVDEC
TAAFDEFLRRAVNIEAMTLNCIGMLHSRYEKVRTSALNVFSDLVNFTMQEGLISSPSKSR
SLHSEFPLEQKWHIWIEDEIRRRTGYLIWLLDCTLAYDFDNRPLLSLDDGQAPLPSHESL
WQTQTSERWSEVGKKSAGPRDVSLYSAVLTIYIEKRLVPEIGEFSHVLLIHALYHRMWEV
GDYFRRPLSFWNPTAKKQSLETAIPSGSVWLPGIPSYSKWRNSACDCLDILHWTANSTIA
KAAGLEHPTVLHLHAARMVLLAPFREIRSLATSLALGKVRWSEHQQALEWHYILRWIKHD
QYKARLAIIHAGTTLWHVRRYSTNAFHEPIAVYLSILTLWAYGSCHAQQLQEPNSRYAAR
YQQTHEPTFIHLDRPCDDELVQLFVREGYSMRGNVMGVGDICAPAGPVLVLQAGCEILAG
LSSWGITKRFIAILTKLAELSSQPRVPEHAQPDHG
Download sequence
Identical sequences A1CBF2
5057.CADACLAP00001381 XP_001274496.1.35617 ACLA_015080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]