SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5057.CADACLAP00004188 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5057.CADACLAP00004188
Domain Number 1 Region: 113-154
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000128
Family Zn2/Cys6 DNA-binding domain 0.0051
Further Details:      
 
Domain Number 2 Region: 55-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000572
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5057.CADACLAP00004188
Sequence length 472
Comment (Aspergillus clavatus)
Sequence
MRAIPCDGAYPSYPSISVIPIQHPIIPHSSLRWRHNPLCSCTMESESSQTQALFHCAHPG
CHRSYRRKEHLNRHAASHRQVAPVGCPYCSSVFARNDTLRHHIRQRHKDKHVDHTRAVKA
CEYCRAQRSRCRGREKAPCEACVQRGISCSLAVVLVSSSGSASTSAPATPRHDGQSTQRA
VHNSSSSETSPGDMRFSPRSLERGTVNVKPFVEAFFERFHPSWPFLHRATFDPAHEPPFL
LQSVLMIGLWVMGDPKRQEAACALHEKLCLSIYQQKDKWEVTDLDSAKPTPWPMATYQGI
LLHIIFALLRQDPTHLNISFTYTLPRLPSQLLTTLVYTCLRQKMFFYPTILGQFIPGSVP
DSFIWIGIEEIKRFALALYKVCRLCIVHDDTGHTTQMHGPPTVTGHARTLVSLEDLQFAL
PDSDDLWHASSDLAARLAEDGSMAYKNKNAEANWISQSVRLLRKNEVGFDWI
Download sequence
Identical sequences A1C8T0
5057.CADACLAP00004188 XP_001275143.1.35617 ACLA_044370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]