SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5057.CADACLAP00006537 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5057.CADACLAP00006537
Domain Number 1 Region: 24-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000017
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 93-129
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000244
Family Zn2/Cys6 DNA-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5057.CADACLAP00006537
Sequence length 185
Comment (Aspergillus clavatus)
Sequence
MNTRFFQYTVMDHKSNSNTMDGGRLRCDVCSCTFRRSDHLKRHSRIHNPPRPHKCQFCGS
TYTRGDVLRRHWTTCAKRRESGQAVPQAEAGGKQKHACDACARLKKACNGQRPCGECESR
GKPCSYQRLQGDEQPSSKRRRTTVGLDDRQDWGTQGFGYQTLLPPKLTYEDYRARIGKIL
PGIGC
Download sequence
Identical sequences A1C7A2
5057.CADACLAP00006537 ACLA_073080 XP_001275699.1.35617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]