SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00000170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00000170
Domain Number 1 Region: 19-68
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000189
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 92-131
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000706
Family Zn2/Cys6 DNA-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00000170
Sequence length 872
Comment (Aspergillus flavus)
Sequence
MASPFTSPRSAPGTRPLNRNLYQCGTCSQSFSRVDHLSRHVRSHTQEKPYKCPVCSKRFG
RIDLLNRHSSLHNTDGDGPVSKKRRRNGCNTTMIARASQACTACAEDHLRCDEEKPCKRC
QRRNIQCKVPPKQIDELSTSPTIPEMQNAGGDPSSLSNPTSKPDITNDQLYQMSASPPAE
IPAADIWSQVPSHHAPTDPEIDVSASLTKAYPDLITPDSVDMLTAGLSMDSLSGVRTPRG
LITFGLETDLDLSMVDLSFLESYNSRIPFQFDEHETPPSFSGSALGDCAAGTSYSTPNDR
SMQRLRWHFVPEPQDHGYAEHNNLLLPTHADQNSTPRNFIDMDSYCNAESLDLASRDKIL
SIFLSQMKHPISQATLSFPSVELLDILIRYCLTSPRSNAKSWIHLATFTPKQTRPELLLA
MAAMGAVLTPDPSLQKLGFAMQEVVRHQLPVVFESDNTMINNLELLQAYMLCLETGLWSG
NNRKMEICESSRLPLITILRRRGLFHHSAYPPVLISPEDASDNLDSKWRSWVRQESFKRL
VYNLLRHDAQLSMVLFTNPLLSYGEISLSIPCSRDLWTASSAQKWKELYCGRLAMGTTRI
PTLLECIANLDLLECSKAVADTTLSCLSILCAMWGMVWEYRQFSILLAAQSRYWDNGILM
VSRYQELVKMLKYFHMGYKNESKLHLNLILMHMHMSLEDVQILATLEDPKKTSGFPPSIH
SWSQSKECRQALWHAGQVIRELKALPSQCLRDFMAVALYHASLTLWAYGMAISHATEDNA
VSRPDSMGMNMENIVWLDGDDTEGVHRYIALEHGIPALHGAQPHIASASLAEPGAILELV
LQIMHRNHYGEREPPLVENLVHLIEKLRDVSK
Download sequence
Identical sequences B8MW40
5059.CADAFLAP00000170 XP_002372305.1.25037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]