SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00008993 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00008993
Domain Number 1 Region: 92-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000742
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 2 Region: 134-176
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000565
Family Zn2/Cys6 DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00008993
Sequence length 634
Comment (Aspergillus flavus)
Sequence
MHLSPLLSYGDLFFYPRCHAKFSSTVCLKEQSSVRRHVPGEQRRWPRYEFGYIFLPSRAS
RSYLVKDVRTHRRTTLSDRNNYDNEIQPTSTGSSQTKCSICHSTFRRPEHLKRHFRSHTK
EKPFECTQCGRHFSRTYTFRACFKCAVARVRCSGGTPCIRCDNRSLECQYPTERRSKAKA
RKQSSRNQDSVDGSPQEQVSRHARSPSAANTDITLALNGGKPSSQIPGYQLGQFQIQMSG
QSSSKTTSSSREHLSEHLNDPQDSRQASEPENLDLSNNSGVIDITRFPFDSYAGVNLQQL
YPQMPTSDIRATLSGDQGARLNHQVQPEIPGSNINMGMVVAHNQQLQLGFTQPYLDPAMA
STINWLSNDLLLNTTGERPTGDRPPPHSSQGGTIDSSLGQSSWLPPVISAEQTSPSLPEH
IYQTPSGNTSLGTDVDSPRHFPRDAAQSSTPQSRPCNASQRSADSYIDGGGARLPKYRRK
QDPGLRPASIVDVRFQLCPTGGPSKFSFPTIQGLREEISSEEVAFKFQIEPAMYDNIYQG
FIQLCCTENFLYSKFENKNFPPREALSHFIGLYFDSFQTVYPILHGPTFNPNSCHWLLTM
AVSAIGSYAAGIDEQDNCSAAFSEFLRRAIHTEV
Download sequence
Identical sequences B8NKQ4
5059.CADAFLAP00008993 XP_002381128.1.25037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]