SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00011896 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00011896
Domain Number 1 Region: 12-57
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000162
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 2 Region: 76-118
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000101
Family Zn2/Cys6 DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00011896
Sequence length 437
Comment (Aspergillus flavus)
Sequence
MPRARKTPPELYCSTCQTIFARKEHYQRHLRTHTKEKPFACTWCGQTFGRVDSLTRHHTT
VHQNPGVEGLGGLVTSRRRVIQACTRCSQSKLRCDGDRPCRRCRDQQSVCHYGPSKRAPN
FDVGDHVSAKPPKVPSGQVAPDGMNYERLYAAERSDPAQYPAPHGVTLPPSPERYSPHGE
AEAMVTMNVTLAPDLSADHLIDFQSWFSVPADNDCWPDLTCYDQDLSVLDIVGPSVTEGS
MQKSWDTQKRNASLPQPNIAEVYRRNQVPEIDKDAVEPRHYDPARTEDDAQLIFPDMTVI
PREDIEAENLAHVEEVPAEVTSTVFELANDMQLKSNYPQFIELRIPPAPVLNAWVQLYFE
HFHPMFPVLHKPTFSTSGSNPFLVLAVAAIGAHFSDIPGAQPCLRAMHELIRRYTSYTVR
ATVPSRSSDDTDRRWKV
Download sequence
Identical sequences B8NTY8
XP_002384031.1.25037 5059.CADAFLAP00011896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]