SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00013198 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00013198
Domain Number 1 Region: 2-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000484
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 64-103
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000687
Family Zn2/Cys6 DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00013198
Sequence length 617
Comment (Aspergillus flavus)
Sequence
MFRCSQCDKSYQRKAHLLRHELTHSGQAASVCPFCKKSFLKPEVARRHSKACAIKYNQQP
APAAKPGRKRQSCDQCFATKRACDKGSPCSRCQSLGQQCTFESQQESSIGSPCPTDVSLS
PSVQTPTPSKEESQFSFLRHFTDPCVERDRLAIGTTAECSVRRNLESLYSHLEDALVPPD
PMAANFGDIPGAEMFFRPPLITDEYFPTDLLSYGPTKLSEQLHELMMELIETSKSMRPDD
TENPQLQLDIAQLAPLFTVSNVAIFISVFFHSLYWHLPVVHFPTFDPGNVSNPLLLSIFL
TGATYSSSLDEAALLPRVLDVAEEHVFRKITTLSTQVAPPTHDLTRQIPTIQLLQAALII
EMLQFGQERVETRRRIRIIRHPSLVSLMRCLGIFQLKRSAPPTVCTGDDSTWRALVTEEV
CIRLASWVFLADGFLTVCFKNRPTISIFEMECPFPWRTELWEAENASAFSRIAATDEAKL
PMPSVREAIRLLLDNSEPGPLPSSLPLSAEHLLIMIYALNSLAFLARTDFFGSVPLKKIK
SAANKWKQIWNSVYQDSNNDQMLLLGYPKHAEELWLLLTTMLDIATENSTKLPYLDNAAT
DDLGKLNEFIQWCCRDT
Download sequence
Identical sequences B8NYB8
XP_002385333.1.25037 5059.CADAFLAP00013198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]