SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5061.CADANGAP00005303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5061.CADANGAP00005303
Domain Number 1 Region: 23-72
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000389
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 2 Region: 92-130
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000183
Family Zn2/Cys6 DNA-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5061.CADANGAP00005303
Sequence length 854
Comment (Aspergillus niger)
Sequence
MLDKSSPSLPAQSPSRPLPKARDGYFQCGFCKKHYNRADHLIRHVRSHTREKPYVCHVCN
KGFARPDLMKRHAAGHDHPRDGKRKRPPQYAKSGRVSQACKACATSKLKCDEEKPCRRCR
DKKLICDWHDAGFDELTPGSPMQATIDNPPFATPDFTVNNYLPDPPDAAPENPPTTSYDG
SLIEAISPALDHESGIFSVDGTFFPEFIPDSLIPSLSRPNEFDPLNSINPTPDYRHNLLN
TNMQFDFDLTDVDFGLIDYFNSQGLSHTAPQPPDAPNDRSDVDSRIALGAEAYKRSSLSA
WKPAQHDHVFADQDDLSVPVVMDSPGSSIRGERQILPERLSSGSRDLIFGMVLQTSEKTA
VPRIIKSFPSTELLDGLIQDYFAYQSHQLDPFIHAPTFYPNEESSDMLTALAASGAVRSA
IPTIRKLGYALMEVARLQMSTKTFAVVIDIGLWSGNGRRTEIAESFQQPLVTVQMLRRAL
RFRRTIYTTIVPSPEDNEEELQKKWHSWIEQESFRRLVHHLFLHDAQCAMMLNVSPLISY
AELELPLPSIRALWDAKSAAAWRDTYLALGLLSTERQPSLVEALRDMSRLQGVVDLQLAG
CILLHGFSAMVNEYHRFSFISKGNPKHWNALVTNSRHQELSQALQHFRMICYEWPSFPIP
EVILIYEMISMLLYMSLEDLQLFAGKEDKNEARRVYHSALDWISSIDSRRAVWHAGQVIR
AAKAIPVGSLTGFLAVGVYYASLAFWSYSVVLKAKNNKLASESRPLGPPSTIRGPTVYLD
GDETTDVQKFISLGCGSPALQGRQGPAFVSDPGQTMDVTQELLRADASHDALPPLVQGLC
QLMNGLGNAARSTT
Download sequence
Identical sequences A2QMA2
CADANGAP00005303 5061.CADANGAP00005303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]