SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5061.CADANGAP00007144 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5061.CADANGAP00007144
Domain Number 1 Region: 69-110
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000000183
Family Zn2/Cys6 DNA-binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 11-61
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000842
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5061.CADANGAP00007144
Sequence length 448
Comment (Aspergillus niger)
Sequence
MSPLRTIQNRFKCRISGCTSSFQRKEHRTRHEGQHTGALARECPLCARTFSRSDSLRRHI
RLDHGPDEPTRVSRACRRCRLAKIRCSGGAPCSRCSAQTRQCVYDDRQRPQQQDQQPQLS
ASTQPSPTSQSLEDHALPCSPLPTVEDHDSTAHFLPYIHLYFTHFHSHWPILHRATFNAS
DEPPLLLQAVSVIGLWVSNKPSAREAAISLHRKQGPSILAQQEKWTGALPFQTETSNNNS
TGSQATASRCPVATYQAILLYLIFSLILRSHGINNTKVNNNNNTDICTTPRSLDLTLSLS
PMDQHILSLLVSTCLRNRIFYYPQMMERYHHTMQSVTCIWIGMEELKRLGLAMYRLCRLC
GTENHSPGSEKDEADVGNGRLVLRISDLQFPPPDSRHLWEAQSDRELSRLLQMEACRGGT
RLDGRDEGNWISSCGRLLDGAEMEQWWF
Download sequence
Identical sequences A5ABA0
5061.CADANGAP00007144 CADANGAP00007144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]