SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5061.CADANGAP00013605 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5061.CADANGAP00013605
Domain Number 1 Region: 53-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000292
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 2 Region: 116-159
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000012
Family Zn2/Cys6 DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5061.CADANGAP00013605
Sequence length 1052
Comment (Aspergillus niger)
Sequence
MSPENSDVGQETVTRPEAEEPTKNDSRSSSSSSRSSNQNHDVPQSSTGTGQTKCSICQST
FRRPEHLKRHFRSHTKEKPFECAQCGRHFSRTDTLHRHELSHHNAGMEGGKDRTHRITVK
TFRACYKCAIARVRCSGGSPCARCESRSLECQYPTERRSKAKTRKETQPSFTNDDASYAQ
SSHLAQSTWANGTDLRPSRNGEQSIPPPFHYQMTQFQLQMPISNTSNAVSSNLSANNNNI
EPENKHLDETRTNGQALGAEDNSTSLSLHDSTREVKKMRVPSVQNGTVRTQGLYSQIATS
TEDMAEPAHRTEGLQSAKGSDGIATMPTVGSQQVPMELIQPLLNQTTVPTINWLPQDLAN
ASNGRRHSINTYQKTSGILDTSLSQAPWYQSVIHGTESSSLVSENVSQTPSGYTSLGGNT
ESPSQSSHLNRRVRNHSVDGALPNSSSSRLNQDSWSLLCAASANASLQLQQADTRRQYLF
PQFPKPRVHATNENHYDHHHTLGPPTYERIRSAFIQLCCAESILYPKFESDHLPDAETLS
SFINLYFVHFQPVYPIFHTPTFDINECHWLVVLALSAIGCHFAGSQEQSECAPVFHEFLR
RAISVEEEKYYVDRAPVWLLQASVLNCVGIVYSCDERARLLALNTFGNLIGFVNREKLLS
RPDRPIQPLNGKTNEQHWLSWVEDEIRRRIGYLIWLLDCTIAYQFDRRPLLSLDESQATL
PSHEALWTAKSLEAWKDDLQLTRRLEDQKESSLYDAVLVMYIEKELVPDIGEFSQLLLIH
ALYHRMWEVGDYFRRPLSFWNPTSKKQSRHSALPSGSVWLPGIPSYSKWRNSACDCLDIL
HWAAGSTVARTAGLEHPTILHLHLARIILLAPFREIRSLATSLAMEESRWCEREQTLEWH
YILRWVKHDQYKARLAVVHAGAMLRHARDFSSRSFHEPVAVFLATLVLWAYGACYTSLSD
MTSRHEASHGMPEKPLFIHLDRPCDDELAQLFVREGQGMKAVLTGVGDICAPQGPEETLK
VGCLILAGLSSWGISKRFTAILGKLSEITSKS
Download sequence
Identical sequences A2RA85
CADANGAP00013605 5061.CADANGAP00013605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]