SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 507522.KPK_A0132 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  507522.KPK_A0132
Domain Number 1 Region: 8-106
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.48e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 507522.KPK_A0132
Sequence length 110
Comment (Klebsiella pneumoniae 342)
Sequence
MDFDEDSMLDTEEVVMGIIVNAGHSRSLCYEALNHAKAGDFDHASKLLEMAAEAGKEAHA
IQTKLIEEDEGMGKTTMTLVMVHAQDHLMTSILCREMITELVQIYKSKLN
Download sequence
Identical sequences B5RK56
gi|206575595|ref|YP_002235780.1| 507522.KPK_A0132 WP_012540146.1.55984 WP_012540146.1.6018 gi|206575595|ref|YP_002235780.1|NC_011282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]