SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00000859 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00000859
Domain Number 1 Region: 14-64
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000151
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 2 Region: 78-114
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000168
Family Zn2/Cys6 DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00000859
Sequence length 715
Comment (Aspergillus fumigatus)
Sequence
MKTSPAYANLATSPHQCSICFKSYKRREHLQRHRNSHSADRPHRCPACPSTFQRADVLRR
HFRTCDRIISSAYQGATRKRACDRCARQKKACNSARPCQNCSKRGVECAYSTPKNDTSAG
TEIASPSISLGADSSNAAPAAATSVDLWTPRTGNDERPDSTGFDAFACPDLGLLQYCDQS
WQDLFNVGSEDLSPTSGDRNYFFHFLDTFTSRTGFVSSFECGTLEQRFMVLYSIEEKERL
SDAFWTIDMDQCSNQESNNSYGVSSQWLNDPLALQTHQILLLIKEVVMIKPRNSCVTISW
SQDIEQRCLQFFSPTSLRKYIELYWLIWSPNVNFLHRPSFHPASSKPILLASMAIIGACV
SPNLEDNDNAWMWFNCVEEAVFADEDFNRDPVSPFSPVRDRQKMQALQAAYMVCLYQNWE
GTDASKKRIRRHRFSTVVSTVRDLDITTARHVDYNAKHRDEFSWNEFRFQVNSPARTFIW
VFLMDTAFVTFNNLPPRMVVKEMKMHVAAPESCFQAPTADQCYDAIRHWMPSASLCWKFS
FRALFETLCIDDLTVKMQQAVAALGPLNLFTIISGIHSLVFHYQSFFSAGNLLSRTHTAL
QNFKHIWHLHETTAIGRLPHTTVDESNLNADNMWQRVGFCRHAGDFWLLASVKVDRLSVA
EAEQHRATRGELVPDDSEQSDPILPQYDQTSMRQVNELISEFQRVHLGDMPSAVD
Download sequence
Identical sequences Q4WB20
5085.CADAFUAP00000859 Afu8g00750 XP_747130.1.65241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]