SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00001200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00001200
Domain Number 1 Region: 23-72
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000269
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 91-130
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000131
Family Zn2/Cys6 DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00001200
Sequence length 874
Comment (Aspergillus fumigatus)
Sequence
MATDSPLPILATSPPSSLAGQRDGYFQCGSCAKRYNRADHLIRHVRTHTREKPYVCDVCN
KGFARPDLMKRHAAGHIHPRDTKRRRLSSYPKNGRVSQACKTCAASKLKCDDEKPCRRCQ
EKNLVCHWAQGVSSIDGSPPSQRQVCESDQAPHLPIDGQIKPGPPQMASPNAQMDNYLPA
GLQSGLPTMDSDSGVFSVDGTFFPDFIPDSLIPSLSRMSDLDPLPVLPQDSIHNVFDHNV
DFDFDLTDLDYGLIDLFNSRGAVHHHHHHAYNSDGATEHGDADSGIAIGAEAYHRSSLSA
WKPAREDHAFADQENLSVPEAIDSPEANFRPDRQMVSERLSPSGRDRIFGLVLQTSQRTN
LTRIIKSFPSTQLLDSLIQYYFESQCHDIDSWIHGPTFRMNDEAPDMLAALAAAGATRST
IPTIRKLGYALMEIVRLQLSDKYESDNTTIRDLRASQTFALTLEIGIWSGNARRTEIAES
FQQPLVTMMRRGLRFRRSAYPNIAPSPDDDGDILEKKWRDWAHSESFNRLVHHLFLHDAQ
SAMMLNVNPIISYSELELPLPAPRSLWEAKSATDWKEAYLASGLSSHGRTPSLVDTLQDM
SQLSAFQSRIDLQLSTSAVIHGLFTLISEYHRHKFIAKGHSKHWNALVISSRHQELSQAM
QHLRMLCFEMSSALGPRIILVSELISMFLHMSLEELQLFAGKEDKNQARRVYQSALEWIG
SIDSRRAIWHAGQVIRAAKVMPPGSLTGFFALGVYYASLAFWSYSVVSRAKGSPAAVVRP
PSDSHFGGPWPTVYLDGEETADVQRFISLGCGCPALQAPSGAAVITDPGQIMDAIQGILR
GDAHHDNIPPLVQGLTQLMCDLGNAARSKTYAPT
Download sequence
Identical sequences A4DA61
XP_001481416.1.65241 5085.CADAFUAP00001200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]