SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00002484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00002484
Domain Number 1 Region: 64-99
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000051
Family Zn2/Cys6 DNA-binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 10-39
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000101
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00002484
Sequence length 384
Comment (Aspergillus fumigatus)
Sequence
MPPQPLSGSSLPPFQCDHPGCGAKYRRKEHLNRHAASHSRGDCFSCPDLLRRHIRIYHPN
RAPPASRAQKACAACHARKERCYGGFPCSACQKRGIACSPGKGKTPEEQIVDNNVQISQQ
PHPPRWIALDYVDIYFDNFHPKWPFLHRGTFDVTKEPCVLIQSVVMIGLWIEGSKKSREA
ATDLHRSLSTAIRTQMDRWRVFNQNQSTSWPMATYQSVLLQCIFALFLAWERKAIDLNLR
YQIQDDEHDLLVTLVESCRLGGIFSYPNMLAQHSSGVPLTLVWLSLEEIKRFGLALYKVC
RLSTRLDPSRADGSSAQSELLTLADLSFGMPDSDEAWNSISGVGCEVRQEEAFQTKLRDG
QDPTGWISQSASVLSNARVAFDWI
Download sequence
Identical sequences B0YF53 Q4W9D2
XP_746347.2.65241 5085.CADAFUAP00002484 Afum_A1163:AFUB_101600.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]